Predicting MHC-Peptide Binding with Machine Learning

Using machine learning to predict peptide binding affinity to Major Histocompatibility Complex (MHC) molecules.
deep learning
biology
Author

Nicolas Brosse

Published

February 6, 2025

This blog post explores the application of machine learning techniques to predict the binding affinity between peptides and Major Histocompatibility Complex (MHC) molecules. In Section 1, we introduce the biological aspects of MHC. In Section 2, we then present the deep learning approach and the results of MHC antigen presentation.

Understanding Major Histocompatibility Complex (MHC)

The Major Histocompatibility Complex (MHC) is a crucial part of the immune system. It plays a key role in distinguishing between the body’s own cells and foreign invaders. The MHC is a region of DNA containing genes that code for cell surface proteins, known as MHC molecules. These molecules bind to fragments of proteins (antigens) and present them on the cell surface, allowing immune cells called T-cells to recognize and respond to potential threats. This interaction triggers an immune response when necessary.

MHC molecules are involved in:

  • Distinguishing self from non-self: Preventing autoimmune attacks.
  • Activating the immune response: Targeting infected cells.
  • Organ transplantation: Determining donor compatibility.
  • Susceptibility to autoimmune diseases: Some MHC variations are linked to increased risk.
Note

MHC molecules are like cellular “display cases” that present antigens to T cells, triggering an immune response when necessary.

MHC Class I and Class II

MHC molecules are divided into two main classes: MHC class I and MHC class II.

MHC Class I

MHC class I molecules are present on most cells (except red blood cells). They present antigens from inside the cell. When a cell is infected or becomes cancerous, proteins within the cell are broken down into smaller fragments called epitopes. These epitopes are loaded onto MHC class I molecules and displayed on the cell surface. Killer T cells (cytotoxic T lymphocytes or CTLs) recognize these epitopes and can destroy infected or cancerous cells.

Figure 1: MHC class I pathway: Proteins in the cytosol are degraded by the proteasome, liberating peptides internalized by TAP channel in the endoplasmic reticulum, there associating with MHC-I molecules freshly synthesized. MHC-I/peptide complexes enter Golgi apparatus, are glycosylated, enter secretory vesicles, fuse with the cell membrane, and externalize on the cell membrane interacting with T lymphocytes. This figure shows the detailed steps of how MHC Class I molecules get loaded. Source

In humans, the main MHC class I molecules are HLA-A, HLA-B, and HLA-C (HLA stands for Human Leukocyte Antigen).

MHC Class II

MHC class II molecules are primarily found on specialized immune cells called antigen-presenting cells (APCs) like macrophages, dendritic cells, and B cells. They present antigens from outside the cell. APCs engulf foreign invaders and break them down into epitopes in a process called phagocytosis. These epitopes are loaded onto MHC class II molecules and displayed on the cell surface. Helper T cells recognize these epitopes and activate other immune cells to fight the infection. These Helper T cells have receptors that specifically bind to MHC Class II molecules. If a helper T cell recognizes a foreign epitope presented by MHC class II, it becomes activated and starts to coordinate the immune response. It releases chemical signals (cytokines) that help other immune cells, like B cells and killer T cells, to fight off the infection.

Figure 2: This diagram shows how MHC class I molecules present antigens from inside the cell to cytotoxic T cells (CD8+), leading to the destruction of infected cells. Notice how the antigen is processed inside the cell and then presented on the cell surface. On the contrary, MHC class II molecules present antigens from outside the cell to helper T cells (CD4+), which then activate other immune cells. Notice how this differs from MHC class I, which presents antigens from inside the cell.(Antunes et al. 2018)
Figure 3: Molecular structures of class I and class II MHCs. Molecular representation of a class I MHC (A, C) and a class II MHC (B, D). The upper panel shows a top view, while the bottom panel shows a cross section side-view of the binding clefts. Note that the binding cleft of a class I receptor is deeper, with “closed” extremities, while the class II cleft is shallower, with open extremities. The pockets involved in binding primary “anchor” residues are indicated. Together, structural differences in the shape of the cleft and the location of binding pockets have an impact on the overall conformation of bound ligands (e.g., peptides tend to adopt bulged conformations when bound to class I, and more linear conformations when bound to class II). (Antunes et al. 2018)

In humans, the main MHC class II molecules are HLA-DP, HLA-DQ, and HLA-DR.

Human Leukocyte Antigens (HLA)

In humans, MHC molecules are called Human Leukocyte Antigens (HLAs). The genes for HLA proteins are located within the MHC region on chromosome 6.

HLAs are important for:

  • Organ transplantation: HLA matching is crucial to prevent organ rejection.
  • Autoimmune diseases: Certain HLA types are associated with increased risk of autoimmune diseases.
  • Drug responses: HLA variations can influence how individuals respond to certain medications.
  • Evolutionary advantage: HLA diversity is important for population survival against various pathogens.
Codominant expression of HLA genes
Figure 4: Codominant expression of HLA genes. Each person inherits HLA genes from both parents, resulting in the expression of multiple HLA types. This increases the diversity of antigens that can be presented. Source

MHC Diversity

The MHC is highly diverse, with many different versions (alleles) of each MHC gene. This diversity is essential because different MHC molecules bind to different peptides. A diverse population is more likely to have individuals who can present antigens from new pathogens, ensuring better survival chances for the species.

Datasets

The IPD-IMGT/HLA Database is a specialized resource focusing on the sequences of the human major histocompatibility complex (MHC) or human leukocyte antigen (HLA) system. It provides comprehensive information about HLA alleles, including their sequences, nomenclature, and associated metadata. This database is crucial for researchers in immunology, transplantation, and vaccine development, as accurate HLA typing is essential for understanding immune responses and predicting transplant compatibility. The IEDB (Immune Epitope Database) is a widely used resource for curated experimental data on immune epitopes. It catalogs epitopes recognized by T cells and B cells in various diseases and conditions. The IEDB facilitates research in epitope discovery, vaccine design, and understanding immune recognition, offering tools and data for analyzing and predicting immune responses.

Predicting MHC Binding: A Machine Learning Approach

Relevance to Machine Learning

The interaction between an MHC molecule and a peptide is highly dependent on the amino acid sequence of the peptide and the specific type of MHC molecule. This sequence-structure-function relationship makes MHC-peptide binding prediction a suitable problem for machine learning. Experimental data on MHC-peptide binding affinities, though sometimes sparse, is available for training and evaluating predictive models. The high polymorphism of MHC genes, with numerous variants (alleles) existing in the population, adds complexity and motivates the development of specific prediction models.

Key MHC Concepts:

  • MHC Class I and Class II: The two main classes of MHC molecules.
  • Epitope: The specific part of the peptide recognized by the T cell receptor.
  • Polymorphism: The existence of multiple versions (alleles) of MHC genes within a population. Different MHC alleles bind to different sets of peptides.
  • Binding Affinity: The strength of the interaction between an MHC molecule and a peptide. Often measured experimentally, it serves as the target variable for many machine learning models.

Machine Learning Approaches

MHC-peptide binding prediction aims to develop models that accurately predict the binding affinity between a given peptide sequence and a specific MHC allele. This can be framed as a regression or classification task.

  • Input: Peptide sequence, MHC allele (represented as a sequence or encoding).
  • Output: Binding affinity (e.g., IC50 value, Kd value) or a binary label (binder/non-binder).

Feature engineering and model selection are crucial for building effective predictors. Common approaches include:

  • Sequence-based Features: Amino acid composition, n-grams, physicochemical properties.
  • Structure-based Features: (If available) Information about the 3D structure of the MHC-peptide complex.
  • MHC Allele Encoding: Techniques such as one-hot encoding, amino acid embeddings, or other methods to represent the MHC allele sequence.
  • Machine Learning Algorithms: Linear regression, Support Vector Machines (SVMs), Random Forests, Neural Networks (including Convolutional Neural Networks and Transformers).

Project Overview

Note

The code is available at https://github.com/nbrosse/mhcpred.

The goal of this project is to build a machine learning classifier that predicts whether a given peptide will be presented by a specific MHC class I protein, identified by its allele name. The data used for this project is derived from the training and evaluation data of NetMHCPan4.1 (Reynisson et al. 2020), a well-established framework for MHC binding prediction. The data is split into training and testing sets, with the training data further divided into five folds for cross-validation.

The dataset contains a binary target variable, “hit” (1 if the peptide is presented by the MHC, 0 otherwise), and two features:

  • “peptide”: The amino acid sequence of the peptide. These short chains of amino acids are potential antigens that could be presented to the immune system.

  • “allele”: The name of the MHC class I allele. MHC molecules are highly polymorphic, meaning there are many different versions (alleles) within the human population. Each allele has a slightly different binding groove, affecting which peptides it can bind and present. You can find details on the naming convention here (nomenclature).

Note

Predicting MHC antigen presentation is a complex field. This project provides a simplified introduction to the problem. For a more in-depth understanding, we recommend exploring NetMHCPan (Reynisson et al. 2020) and MHCflurry (O’Donnell, Rubinsteyn, and Laserson 2020) and the references cited within those publications. Note that the specific data used in this project is derived from NetMHCPan4.1 but must remain private.

We begin with Exploratory Data Analysis (EDA) to understand the characteristics of our data.

EDA

# Import data loading functions
from mhcpred.data import get_train_data, get_test_data

# Load training and test data
df_train = get_train_data()
df_test = get_test_data()
# View first few rows of training data
df_train.head()
peptide allele hit fold
0 YFPLAPFNQL HLA-C*14:02 True 0
1 KESKINQVF HLA-B*44:02 True 0
2 QPHDPLVPLSA HLA-B*54:01 True 0
3 RTIADSLINSF HLA-B*57:03 True 0
4 EEKTIIKKL HLA-B*44:03 True 0
# Get allele counts in training data
df_train[["allele"]].value_counts()
allele     
HLA-A*02:01    265252
HLA-B*07:02    201038
HLA-B*57:01    184773
HLA-A*29:02    181136
HLA-B*40:02    145817
                ...  
HLA-A*69:01        12
HLA-A*02:06         6
HLA-A*26:02         6
HLA-A*26:03         6
HLA-A*25:01         6
Name: count, Length: 130, dtype: int64
df_test["allele"].value_counts()
allele
HLA-A*02:02    77053
HLA-A*02:06    54510
HLA-A*02:11    48445
HLA-B*53:01    46991
HLA-B*15:17    45917
HLA-A*02:05    45136
HLA-B*15:03    44968
HLA-A*33:01    43333
HLA-A*66:01    41538
HLA-C*12:03    36448
HLA-C*03:03    35568
HLA-A*11:01    33424
HLA-A*30:02    33180
HLA-C*08:02    32416
HLA-A*23:01    30467
HLA-A*32:01    28036
HLA-B*40:02    23768
HLA-B*14:02    21601
HLA-B*37:01    20048
HLA-B*40:01    18908
HLA-B*45:01    18750
HLA-B*18:01    18284
HLA-B*58:01    17946
HLA-B*15:02    16702
HLA-B*15:01    16624
HLA-A*30:01    15837
HLA-C*07:02    15293
HLA-B*46:01    14015
HLA-B*38:01     9509
HLA-B*35:03     8275
HLA-A*26:01     7730
HLA-C*05:01     7033
HLA-A*25:01     6906
HLA-A*68:01     5648
HLA-B*08:01     3365
HLA-B*07:02     2469
Name: count, dtype: int64
# Get positive samples per allele in training
df_train.groupby("allele").hit.sum()
allele
HLA-A*01:01     7156
HLA-A*01:03        7
HLA-A*02:01    13025
HLA-A*02:03     1873
HLA-A*02:04     3155
               ...  
HLA-C*12:04        3
HLA-C*14:02     2441
HLA-C*15:02     1873
HLA-C*16:01     2970
HLA-C*17:01      602
Name: hit, Length: 130, dtype: int64
df_train.hit.sum()
197547
len(df_train)
3679405
# ~5.37% positive rate
df_train.hit.sum() / len(df_train)
0.05368993084479692
df_test.groupby("allele").hit.sum()
allele
HLA-A*02:02    3063
HLA-A*02:05    2016
HLA-A*02:06    1975
HLA-A*02:11    2035
HLA-A*11:01    2309
HLA-A*23:01    1697
HLA-A*25:01     396
HLA-A*26:01     555
HLA-A*30:01     892
HLA-A*30:02    2415
HLA-A*32:01    1436
HLA-A*33:01    2138
HLA-A*66:01    1988
HLA-A*68:01     433
HLA-B*07:02     159
HLA-B*08:01     180
HLA-B*14:02    1056
HLA-B*15:01     769
HLA-B*15:02     637
HLA-B*15:03    1953
HLA-B*15:17    1712
HLA-B*18:01     784
HLA-B*35:03     330
HLA-B*37:01    1253
HLA-B*38:01     619
HLA-B*40:01    1268
HLA-B*40:02    1333
HLA-B*45:01     760
HLA-B*46:01     575
HLA-B*53:01    2016
HLA-B*58:01     866
HLA-C*03:03    2003
HLA-C*05:01     383
HLA-C*07:02     593
HLA-C*08:02    1546
HLA-C*12:03    1273
Name: hit, dtype: int64
df_test.hit.sum() / len(df_test)
0.04800130213150049
# Find alleles only in test set
set(df_test.allele.unique()) - set(df_train.allele.unique())
{'HLA-A*02:02', 'HLA-A*02:11', 'HLA-A*33:01', 'HLA-B*53:01'}
  • Dataset Class Imbalance
    • Training Set:
      • Total samples: 3,679,405
      • Positive rate: 5.37%
    • Test Set:
      • Total samples: 453,934
      • Positive rate: 4.8%
  • Allele Distribution
    • Most frequent: HLA-A*02:01 (265,252 samples)
    • Least frequent: Multiple alleles with only 6 samples
    • Distribution: Highly imbalanced across alleles
  • Test-Only Alleles
    • HLA-A*02:02
    • HLA-A*02:11
    • HLA-A*33:01
    • HLA-B*53:01
Source: EDA

Using MHCflurry Pretrained Models for Prediction

We leverage the mhcflurry package to build our classifier. MHCflurry is a tool specifically designed for MHC binding affinity prediction. See also the associated paper (O’Donnell, Rubinsteyn, and Laserson 2020). MHCflurry is a software package focused on predicting how strongly peptides bind to MHC class I molecules. It’s based on machine learning models trained on a large dataset of experimentally measured peptide-MHC binding affinities. The current version uses neural networks trained with a mix of binding affinity and mass spectrometry data (ligand presentation).

We use the Binding Affinity pretrained model from mhcflurry to predict the binding affinity of peptides to MHC class I molecules using Class1AffinityPredictor. The following code assumes you have installed mhcflurry and downloaded the required pretrained models.

mhcflurry-downloads fetch models_class1_presentation
python scripts/mhcflurry_benchmark.py
def predict_with_mhcflurry() -> pd.DataFrame:
    predictor = Class1AffinityPredictor.load()
    df_test = get_test_data()
    mhcflurry_predictions = predictor.predict_to_dataframe(
        peptides=df_test.peptide.values,
        alleles=df_test.allele.values,
        allele=None,
    )
    df = pd.merge(df_test, mhcflurry_predictions, on=["allele", "peptide"], how="left")
    df.to_csv(str(output_path / "mhcflurry_predictions.csv"), index=False)
    return df

The output is of the form:

Table 1: MHCflurry pretrained model predictions.
peptide hit allele prediction prediction_low prediction_high prediction_percentile
AAPATRAAL True HLA-B*35:03 94.297 59.902 144.624 0.205
AAPSAAREL True HLA-B*35:03 116.19 79.847 169.241 0.262
AEISQIHQSVTD True HLA-B*35:03 26103.26 22695.389 28415 15.739
ALEEQLQQIRAE True HLA-B*35:03 24797.131 19988.967 28062.65 13.571
AQDPLLLQM True HLA-B*35:03 2164.336 745.888 5390.727 1.413
ASAPPGPPA True HLA-B*35:03 1398.729 387.675 3293.692 1.157
DAHKGVAL True HLA-B*35:03 84.315 54.736 133.899 0.175
DNPIQTVSL True HLA-B*35:03 1386.767 565.122 3667.21 1.151
DPEAFLVQI True HLA-B*35:03 245.485 133.986 394.752 0.484

The first 3 columns come from the test dataset.

  • peptide: The amino acid sequence of the peptide being evaluated.
  • hit: The ground truth, a boolean value indicating whether the peptide is known to be presented by the given MHC allele (True) or not (False).
  • allele: The name of the MHC class I allele being considered.

The following columns are added by the binding affinity predictions:

  • prediction: The raw prediction score from the MHCflurry model. Higher values generally indicate a stronger predicted binding affinity. These values are not directly interpretable in isolation.
  • prediction_low/prediction_high: These represent the lower and upper bounds of a 95% confidence interval around the prediction value. They provide an estimate of the uncertainty associated with the prediction.
  • prediction_percentile: This is the most useful column for interpreting the results. It represents the percentile rank of the prediction score compared to a background distribution of scores for random peptides. A lower percentile indicates a stronger predicted binding affinity. For example, a percentile of 1.0 means that the predicted score is in the top 1% of all possible scores.

The uncertainty estimation comes from the ensemble of neural networks used for the prediction. A percentile threshold (e.g., 2%) is commonly used to determine whether a peptide is likely to bind (lower is better).

Prediction: Fitting a Class1BinaryNeuralNetwork

We now fit a Class1BinaryNeuralNetwork on the training dataset. The code is available at https://github.com/nbrosse/mhcpred.

Here’s a glimpse of the training data structure:

Table 2: Training data.
peptide allele hit
YFPLAPFNQL HLA-C*14:02 True
KESKINQVF HLA-B*44:02 True
QPHDPLVPLSA HLA-B*54:01 True
RTIADSLINSF HLA-B*57:03 True

Challenges arise in encoding the peptide and allele sequences for use in a neural network. Peptides have variable lengths, and alleles are represented by their names.

The MHCFlurry package provides a mapping between alleles and their corresponding MHC molecule sequences within the allele_sequences.csv file. This mapping is crucial for encoding the alleles.

Table 3: Allele sequences.
Allele Sequence
HLA-A*01:01 YFAMYQENMAHTDANTLYGIIYDRDYTWVARVYRGYA
HLA-A*01:02 YSAMYQENMAHTDANTLYGIIYDRDYTWVARVYRGYA
HLA-A*01:03 YFAMYQENMAHTDANTLYGIMYDRDYTWVARVYRGYA
HLA-A*01:04 YFAMYQENMAHTDANTLYGIIYDRDYTWVARVYRGYX
HLA-A*01:06 YFAMYQENMAHTDANTLYGIIYDRDYTWVALAYRGYA

First, we import necessary libraries. We also import components from our own mhcpred library, which contains the neural network architecture and data loading functions.

import pickle
from pathlib import Path
from typing import Iterator

import numpy as np
import pandas as pd
from mhcflurry.allele_encoding import AlleleEncoding
from mhcflurry.encodable_sequences import EncodableSequences
from sklearn.model_selection import train_test_split

from mhcpred.class1_binary_nn import Class1BinaryNeuralNetwork
from mhcpred.config import settings
from mhcpred.data import get_test_data, get_train_data
from mhcpred.hyperparameters import base_hyperparameters

We load the allele sequences, training data, and test data using helper functions. The allele sequences are crucial for encoding the MHC alleles.

allele_sequences = pd.read_csv(
    str(data_path / "allele_sequences.csv"), index_col=0
).iloc[:, 0]

df_total_train = get_train_data()
df_test = get_test_data()

We determine the alleles present in our data and filter the loaded allele sequences to only include those we’ll be using.

alleles_in_use = set(df_total_train.allele).union(set(df_test.allele))
allele_sequences_in_use = allele_sequences[allele_sequences.index.isin(alleles_in_use)]

The AlleleEncoding class is designed to cache encodings for a sequence of alleles. It maps allele names to integer indices and sequences, allowing consistent use of these mappings, especially as inputs to neural networks. The EncodableSequences class is used to encode variable-length peptides into fixed-size numerical matrices. It caches various encodings of a list of sequences and provides methods to encode these sequences into fixed-length categorical or vector representations.

We also split the training data into training and validation sets using train_test_split from sklearn. Stratified splitting ensures the class balance is maintained across the training and validation sets. The validation data is also preprocessed by encoding the peptides and alleles.

allele_encoding = AlleleEncoding(
    alleles=allele_sequences_in_use.index.values,
    allele_to_sequence=allele_sequences_in_use.to_dict(),
)

df_train, df_val = train_test_split(
    df_total_train, test_size=0.1, shuffle=True, stratify=df_total_train.hit.values
)

val_peptides = EncodableSequences(df_val.peptide.values)
val_alleles = AlleleEncoding(
    alleles=df_val.allele.values,
    allele_to_sequence=allele_sequences_in_use.to_dict(),
)

AlleleEncoding provides a robust and efficient way to manage and encode allele sequences. It handles the complexities of mapping allele names to indices, storing and padding sequences, and providing different encoding options. The AlleleEncoding class manages allele sequences efficiently:

  1. Allele Universe vs. Used Alleles: The class distinguishes between two sets of alleles:
  • Allele Universe: The complete set of alleles the system knows about. This is defined by the allele_to_sequence dictionary, mapping allele names to their amino acid sequences.
  • Used Alleles: The specific set of alleles used in a particular analysis or task. This is provided as a list when creating an AlleleEncoding instance.
  1. allele_to_index Mapping: A dictionary (self.allele_to_index) is created to map each allele in the universe to a unique integer index. This includes a special index for None values, often used as padding. This mapping ensures consistency: the same allele always gets the same index.

  2. Sequence Storage (self.sequences): The amino acid sequences for all alleles in the universe are stored in a Pandas Series (self.sequences). Critically, these sequences are padded to the same length using “X” characters. This padding is essential for creating fixed-length numerical representations, which many machine learning models require.

  3. Borrowing (borrow_from): The borrow_from parameter allows you to create a new AlleleEncoding instance that inherits the allele universe and mappings from an existing instance. This is a powerful way to ensure consistency across different parts of your code. You don’t have to redefine the allele_to_sequence mapping every time.

  4. Encoding: The class provides methods to encode the allele sequences into numerical matrices, suitable for machine learning.

  • allele_representations(encoding_name): Encodes the entire allele universe. This is useful for pre-calculating encodings for all known alleles.
  • fixed_length_vector_encoded_sequences(encoding_name): Encodes the used alleles (the subset provided when the object was initialized). This uses the pre-calculated encodings from allele_representations and selects only the encodings for the alleles in self.alleles, in the correct order. This gives you a matrix where each row represents an allele sequence.
  1. Encoding Methods (encoding_name): The type of encoding can be specified using the encoding_name parameter. Common options include “BLOSUM62” (a substitution matrix) and “one-hot” encoding.

BLOSUM62 (Blocks Substitution Matrix) is a widely used substitution matrix in bioinformatics. It represents the likelihood of one amino acid being substituted for another during evolution. The matrix assigns a score to each pair of amino acids, reflecting their similarity. Higher scores indicate a higher probability of substitution (or that the two amino acids are more similar). Negative scores indicate substitutions that are less likely or even unfavorable.

The AlleleEncoding class uses BLOSUM62 to convert amino acid sequences into numerical representations. Each amino acid in the sequence is replaced by a vector of 21 numbers (20 amino acids + the “X” character). Each of these 21 numbers is the BLOSUM62 score between the amino acid in the sequence and the amino acid represented by the position in the 21-element vector.

  1. Amino Acid Indexing: First, each amino acid is converted to an index. There’s a mapping from amino acid letter to index.

  2. BLOSUM62 Lookup: For each amino acid in the sequence, the code looks up its corresponding row in the BLOSUM62 matrix. This row represents the similarity scores between that amino acid and all other amino acids (and ‘X’).

  3. Vector Representation: The row from the BLOSUM62 matrix becomes the vector representation of that amino acid. So, “M” would be represented by a vector of 21 numbers (the scores of M with every other amino acid and X), and “A” would also be represented by its own 21-number vector.

  4. Sequence Encoding: The encoded sequence becomes a matrix. If the original sequence was of length n, the encoded sequence is now an n x 21 matrix.

The train_data_iterator function is a generator that yields batches of training data. This function also handles filtering of alleles that might be present in the training data but not in the allele_sequences data to handle potential data inconsistencies.

def train_data_iterator(
    df_train: pd.DataFrame,
    train_allele_encoding: AlleleEncoding,
    batch_size: int = 1024,
) -> Iterator[tuple[AlleleEncoding, EncodableSequences, np.ndarray]]:
    """
    This function creates a data generator for training the neural network.
    It iterates over the training data in batches and yields tuples of 
    (allele_encoding, peptide_sequences, labels).  It also handles filtering
    of alleles not found in the initial allele encoding.
    """
    # Get unique alleles in the training set.
    alleles = df_train.allele.unique()
    # Filter alleles to keep only those for which sequences are available.
    usable_alleles = [
        c for c in alleles if c in train_allele_encoding.allele_to_sequence
    ]
    print("Using %d / %d alleles" % (len(usable_alleles), len(alleles)))
    print(
        "Skipped alleles: ",
        [c for c in alleles if c not in train_allele_encoding.allele_to_sequence],
    )
    df_train = df_train.query("allele in @usable_alleles")

    # Calculate the number of batches.
    n_splits = np.ceil(len(df_train) / batch_size)

    # Infinite loop to allow for multiple epochs.
    while True:
        # Split the training data into batches.
        epoch_dfs = np.array_split(df_train.copy(), n_splits)
        for k, df in enumerate(epoch_dfs):
            if len(df) == 0:
                continue
            # Encode peptides and alleles for the current batch.
            encodable_peptides = EncodableSequences(df.peptide.values)
            allele_encoding = AlleleEncoding(
                alleles=df.allele.values,
                borrow_from=train_allele_encoding,  # Reuse encoding from main allele_encoding
            )
            # Yield the encoded data and labels (hit column).
            yield (allele_encoding, encodable_peptides, df.hit.values)

The neural network model is initialized using the Class1BinaryNeuralNetwork class. Base hyperparameters are used for initialization. The model is then trained using the fit_generator method. This method takes the training data generator, validation data, and other parameters like the number of epochs and steps per epoch. The steps_per_epoch is calculated based on the training data size and batch size.

model = Class1BinaryNeuralNetwork(**base_hyperparameters)
steps_per_epoch = np.ceil(len(df_train) / batch_size)
batch_size = 1024  # Define batch_size here

train_generator = train_data_iterator(df_train, allele_encoding, batch_size) #create the generator

model.fit_generator(
    generator=train_generator,
    validation_peptide_encoding=val_peptides,
    validation_affinities=df_val.hit.values,
    validation_allele_encoding=val_alleles,
    validation_inequalities=None,
    validation_output_indices=None,
    steps_per_epoch=steps_per_epoch,
    epochs=2,
)

The Class1BinaryNeuralNetwork neural network takes two inputs:

  • Allele: A single input representing the MHC allele.
  • Peptide: A sequence of 45 amino acids represented as a 21-dimensional vector for each amino acid (likely using BLOSUM62 encoding or a similar technique).

The network then processes these inputs through several layers:

  1. Embedding Layer: The allele input is passed through an embedding layer. This layer learns a 777-dimensional vector representation for each allele, capturing its key characteristics relevant to peptide binding.

  2. Flatten Layers: These layers reshape the input data. The peptide input, which is initially a 45x21 matrix, is flattened into a 945-element vector. Similarly, the 1x777 allele embedding is flattened into a 777-element vector. This prepares the data for the subsequent dense layers.

  3. Concatenate Layer: The flattened representations of the peptide and allele are combined into a single 1722-element vector. This crucial step merges the information from both inputs, allowing the network to learn the combined effect of allele and peptide on binding affinity.

  4. Dense Layers: These are fully connected layers. The first dense layer transforms the 1722-element vector into a 1024-element vector, and the second further reduces it to 512 elements. These layers learn complex non-linear relationships between the combined allele and peptide representation, extracting features crucial for predicting binding affinity.

  5. Dropout Layers: Dropout is a regularization technique. During training, these layers randomly “drop out” (ignore) a fraction of neurons. This prevents the network from overfitting to the training data and improves its ability to generalize to unseen data.

  6. Output Layer: The final dense layer has a single output neuron. This neuron outputs a single value, representing the predicted binding affinity between the given peptide and MHC allele. Since we’re predicting a binary “hit” variable, a sigmoid activation function is used in this layer to output a probability between 0 and 1.

This architecture is designed to effectively learn the complex patterns governing MHC-peptide binding.

Finally, the trained model is used to make predictions on the test data. The test data is preprocessed in the same way as the training data, and the predict method of the model is used to generate predictions. These predictions are then added to the test dataframe and saved to a CSV file.

test_peptides = df_test.peptide.values
test_allele_encoding = AlleleEncoding(
    alleles=df_test.allele.values,
    allele_to_sequence=allele_sequences_in_use.to_dict(),
)

predictions = model.predict(
    peptides=test_peptides,
    allele_encoding=test_allele_encoding,
)

df_test["predictions"] = predictions
df_test.to_csv(str(output_path / "mhcpred_predictions.csv"), index=False)

We evaluate the predictions of the two methods (mhcflurry and mhcpred) using standard binary classification metrics.

Metrics

This notebook contains training metrics history and classification metrics computed on the predictions by - mhcflurry (benchmark) - mhcpred

from pathlib import Path
import pickle

from mhcpred.config import settings
import pandas as pd
from sklearn.metrics import accuracy_score, confusion_matrix, balanced_accuracy_score
from sklearn.metrics import classification_report
from sklearn.metrics import ConfusionMatrixDisplay
import matplotlib.pyplot as plt

models_path = Path(settings.models_path)
output_path = Path(settings.output_path)

Information on the training history

I prefer to use tensorboard, but it is not implemented in the mhcflurry package. The information is quite scarce, but when you execute the code, you have the loss for each step and not only for the whole epoch. Of course, it is a very basic version of logging and should be improved.

with open(str(models_path / "model.pickle"), "rb") as f:
    model = pickle.load(f)
model.fit_info
[{'learning_rate': 0.0010000000474974513,
  'loss': [0.09700655937194824, 0.06465369462966919],
  'val_loss': [0.06880103051662445, 0.05075661838054657],
  'time': 524.7155420780182,
  'num_points': 6628048}]

Binary classification metrics

We compute the usual binary classification metrics on the unbalanced test dataset: accuracy, balanced accuracy, confusion matrix and classification report by scikit-learn.

We report the unbalanced accuracy because the dataset is very unbalanced so the accuracy only is not a good measure of accuracy (the model can predict always False and it works quite well).

mhcflurry metrics

mhcflurry_rank_percentile_threshold = 2  # rank threshold for positive hits
# It comes from the mhcflurry article.
df = pd.read_csv(str(output_path / "mhcflurry_predictions.csv"))
y_pred = df.prediction_percentile.values <= mhcflurry_rank_percentile_threshold
y_true = df.hit.values
acc = accuracy_score(y_true=y_true, y_pred=y_pred)
confusion_mat = confusion_matrix(y_true=y_true, y_pred=y_pred)
balanced_acc = balanced_accuracy_score(y_true=y_true, y_pred=y_pred)
class_report = classification_report(y_true=y_true, y_pred=y_pred, output_dict=False)

disp = ConfusionMatrixDisplay(confusion_matrix=confusion_mat)
disp.plot()
plt.show()

print(class_report)
              precision    recall  f1-score   support

       False       0.99      0.98      0.99    900996
        True       0.67      0.86      0.76     45423

    accuracy                           0.97    946419
   macro avg       0.83      0.92      0.87    946419
weighted avg       0.98      0.97      0.97    946419
acc, balanced_acc
(0.9731936911663861, 0.9217833819652606)

The metrics are quite good. We note that we do not have a good precision on the True class (0.67), the model has a tendency to predict True too often, so we have too many False Positives. We see it on the confusion matrix, 19234 False Positives.

mhcpred metrics

mhcpred_proba_threshold = 0.5  # by default, but we try to tune it later
df = pd.read_csv(str(output_path / "mhcpred_predictions.csv"))
y_true = df.hit.values
y_pred = df.predictions.values >= mhcpred_proba_threshold
acc = accuracy_score(y_true=df.hit.values, y_pred=y_pred)
confusion_mat = confusion_matrix(y_true=df.hit.values, y_pred=y_pred)
balanced_acc = balanced_accuracy_score(y_true=df.hit.values, y_pred=y_pred)

class_report = classification_report(y_true=y_true, y_pred=y_pred, output_dict=False)

disp = ConfusionMatrixDisplay(confusion_matrix=confusion_mat)
disp.plot()
plt.show()

acc, balanced_acc
(0.9731657332258088, 0.7775326900487307)
print(class_report)
              precision    recall  f1-score   support

       False       0.98      0.99      0.99    900725
        True       0.82      0.56      0.67     45416

    accuracy                           0.97    946141
   macro avg       0.90      0.78      0.83    946141
weighted avg       0.97      0.97      0.97    946141

mhcpred has worse performances compared to mhcflurry, see the balanced accuracy. On the True class, in that case, the recall is not good (0.56), the model has a tendency to predict False too often, on the confusion matrix we have 20000 True Negatives. It indicates that if we lower the threshold, we may improve the model.

Threshold tuning

We plot the precision recall curve to try to identify a better threshold.

from sklearn.metrics import precision_recall_curve, PrecisionRecallDisplay

precision, recall, thresholds = precision_recall_curve(y_true=y_true, probas_pred=df.predictions.values)
disp = PrecisionRecallDisplay(precision=precision, recall=recall)
disp.plot()

plt.show()

precision_recall_thresholds = pd.DataFrame({
    "precision": precision[:-1],
    "recall": recall[:-1],
    "thresholds": thresholds,
})
precision_recall_thresholds
precision recall thresholds
0 0.048001 1.000000 0.000114
1 0.048001 1.000000 0.000116
2 0.048001 1.000000 0.000117
3 0.048001 1.000000 0.000125
4 0.048002 1.000000 0.000125
... ... ... ...
889313 1.000000 0.000110 0.992152
889314 1.000000 0.000088 0.992280
889315 1.000000 0.000066 0.992347
889316 1.000000 0.000044 0.992431
889317 1.000000 0.000022 0.992971

889318 rows × 3 columns

A threshold of approx. 0.2 seems to be a good compromise for precision/recall.

mhcpred_proba_threshold = 0.2
df = pd.read_csv(str(output_path / "mhcpred_predictions.csv"))
y_true = df.hit.values
y_pred = df.predictions.values >= mhcpred_proba_threshold
acc = accuracy_score(y_true=df.hit.values, y_pred=y_pred)
confusion_mat = confusion_matrix(y_true=df.hit.values, y_pred=y_pred)
balanced_acc = balanced_accuracy_score(y_true=df.hit.values, y_pred=y_pred)

class_report = classification_report(y_true=y_true, y_pred=y_pred, output_dict=False)

disp = ConfusionMatrixDisplay(confusion_matrix=confusion_mat)
disp.plot()
plt.show()

acc, balanced_acc
(0.9697360118629252, 0.8462451280426622)
print(class_report)
              precision    recall  f1-score   support

       False       0.99      0.98      0.98    900725
        True       0.68      0.71      0.69     45416

    accuracy                           0.97    946141
   macro avg       0.83      0.85      0.84    946141
weighted avg       0.97      0.97      0.97    946141

We see that we have improved the balanced accuracy. We have a deterioration of the precision but a better recall.

Source: Metrics

Conclusion

Major Histocompatibility Complex (MHC) molecules play a crucial role in the adaptive immune system by:

  1. Presenting peptide fragments on cell surfaces
  2. Enabling T-cells to detect foreign or abnormal proteins
  3. Mediating immune responses against pathogens and cancer cells

In this analysis, we compared two approaches for MHC-I binding prediction:

  • MHCflurry: An established prediction method using neural networks
  • MHCpred: Our custom trained implementation using peptide and allele encodings

Both methods demonstrate capability in predicting peptide-MHC binding affinities. This project provides a simplified introduction to MHC binding prediction using machine learning. The field is complex and rapidly evolving, with many specialized tools and techniques available for more advanced analyses.

References

Antunes, Dinler A., Jayvee R. Abella, Didier Devaurs, Maurício M. Rigo, and Lydia E. Kavraki. 2018. “Structure-based Methods for Binding Mode and Binding Affinity Prediction for Peptide-MHC Complexes.” Current Topics in Medicinal Chemistry 18 (26): 2239–55. https://doi.org/10.2174/1568026619666181224101744.
O’Donnell, Timothy J, Alex Rubinsteyn, and Uri Laserson. 2020. “MHCflurry 2.0: Improved Pan-Allele Prediction of MHC Class i-Presented Peptides by Incorporating Antigen Processing.” Cell Systems 11 (1): 42–48.
Reynisson, Birkir, Bruno Alvarez, Sinu Paul, Bjoern Peters, and Morten Nielsen. 2020. NetMHCpan-4.1 and NetMHCIIpan-4.0: improved predictions of MHC antigen presentation by concurrent motif deconvolution and integration of MS MHC eluted ligand data.” Nucleic Acids Research 48 (W1): W449–54. https://doi.org/10.1093/nar/gkaa379.

Citation

BibTeX citation:
@online{brosse2025,
  author = {Brosse, Nicolas},
  title = {Predicting {MHC-Peptide} {Binding} with {Machine} {Learning}},
  date = {2025-02-06},
  url = {https://nbrosse.github.io/posts/mhc/mhc.html},
  langid = {en}
}
For attribution, please cite this work as:
Brosse, Nicolas. 2025. “Predicting MHC-Peptide Binding with Machine Learning.” February 6, 2025. https://nbrosse.github.io/posts/mhc/mhc.html.